;// _lcid="1033" _version="12.0.4518" CLASS MACHINE CATEGORY !!L_MicrosoftOfficeInfoPath12machine CATEGORY !!L_Security POLICY !!L_InfoPathAPTCAAssemblyWhitelist KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security\APTCA PART !!L_Empty LISTBOX EXPLICITVALUE END PART EXPLAIN !!L_InfoPathAPTCAAssemblyWhitelistExplain END POLICY POLICY !!L_MicrosoftIEFeatureControlOptin KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Empty DROPDOWNLIST VALUENAME IEFeatureControls ITEMLIST NAME !!L_None VALUE NUMERIC 0 NAME !!L_InfopathexeandPropertyPanel VALUE NUMERIC 1 NAME !!L_InfPropPanand3rdparty VALUE NUMERIC 2 DEFAULT END ITEMLIST NOSORT END PART EXPLAIN !!L_MicrosoftIEFeatureControlOptinExplain END POLICY POLICY !!L_InfoPathAPTCAAssemblyWhitelistEnforcement KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME APTCA_Whitelist VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_InfoPathAPTCAAssemblyWhitelistEnforcementExplain END POLICY END CATEGORY END CATEGORY CLASS USER CATEGORY !!L_MicrosoftOfficeInfoPath12 KEYNAME Software\Microsoft\Office\12.0\InfoPath CATEGORY !!L_ToolsOptions KEYNAME Software\Microsoft\Office\12.0\InfoPath CATEGORY !!L_General KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_Recentlyusedfilelist KEYNAME Software\Microsoft\Office\12.0\InfoPath PART !!L_Numberofentries NUMERIC VALUENAME MRUSize SPIN 1 MIN 0 MAX 9 DEFAULT 4 END PART EXPLAIN !!L_SetsthenumberofentriesinthefilelistintheFilemenu END POLICY END CATEGORY CATEGORY !!L_Design KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_Entertextdirectionfornewforms KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer PART !!L_DirectionColon DROPDOWNLIST VALUENAME BidiRTLFORM ITEMLIST NAME !!L_LefttoRight VALUE NUMERIC "0" DEFAULT NAME !!L_RighttoLeft2 VALUE NUMERIC "1" END ITEMLIST END PART EXPLAIN !!L_EntertextdirectionfornewformsExplain END POLICY POLICY !!L_DefaultFormatPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer PART !!L_DefaultFormatPart DROPDOWNLIST VALUENAME DefaultSaveFormat ITEMLIST NAME !!L_DefaultSaveFormat12 VALUE "2.0.0.0" DEFAULT NAME !!L_DefaultSaveFormat11 VALUE "1.100.0.0" END ITEMLIST END PART EXPLAIN !!L_DefaultFormatExplain END POLICY END CATEGORY CATEGORY !!L_SpellingGrammar KEYNAME Software\Microsoft\Office\12.0\InfoPath\Proofing POLICY !!L_Checkspellingasyoutype KEYNAME Software\Microsoft\Office\12.0\InfoPath\Proofing VALUENAME CheckSpelling VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY POLICY !!L_Hidespellingerrors KEYNAME Software\Microsoft\Office\12.0\InfoPath\Proofing VALUENAME HideSpellingErrors VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY END CATEGORY CATEGORY !!L_EAFind KEYNAME Software\Microsoft\Office\12.0\InfoPath\FE POLICY !!L_Matchfullhalfwidthforms KEYNAME Software\Microsoft\Office\12.0\InfoPath\FE VALUENAME EqByte VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY POLICY !!L_Matchminusdashcho KEYNAME Software\Microsoft\Office\12.0\InfoPath\FE VALUENAME EqMinus VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY POLICY !!L_Matchchoonusedforvowels KEYNAME Software\Microsoft\Office\12.0\InfoPath\FE VALUENAME EqLongVowel VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY POLICY !!L_SetEAlinebreaking KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\FE PART !!L_SelectEAlinebreakingbehavior DROPDOWNLIST VALUENAME linebreaking ITEMLIST NAME !!L_Normal VALUE "normal" DEFAULT NAME !!L_Strict VALUE "strict" END ITEMLIST END PART EXPLAIN !!L_ChecksUnchecksthecorrespondingUIoption END POLICY END CATEGORY CATEGORY !!L_Ink KEYNAME Software\Microsoft\Office\12.0\InfoPath\EditorCommon POLICY !!L_InkEntry KEYNAME Software\Microsoft\Office\12.0\InfoPath\EditorCommon VALUENAME InkEntry EXPLAIN !!L_InkEntryExplain END POLICY POLICY !!L_DisplaywarningdialogthatuserisenteringtextinInkentrymode KEYNAME Software\Microsoft\Office\12.0\InfoPath\EditorCommon VALUENAME InkEntryPrompt EXPLAIN !!L_DisplaywarningdialogthatuserisenteringtextinInkentrymodeExplain END POLICY POLICY !!L_Entermillisecondsbeforerecognizinghandwriting KEYNAME Software\Microsoft\Office\12.0\InfoPath\EditorCommon PART !!L_Waitmilliseconds010000 NUMERIC VALUENAME InkEntryDelayTime SPIN 1 MIN 0 MAX 10000 DEFAULT 3000 END PART EXPLAIN !!L_EntermillisecondsbeforerecognizinghandwritingExplain END POLICY POLICY !!L_Displayashadedinkguideforhandwriting KEYNAME Software\Microsoft\Office\12.0\InfoPath\EditorCommon VALUENAME InkEntryGuide EXPLAIN !!L_DisplayashadedinkguideforhandwritingExplain END POLICY END CATEGORY CATEGORY !!L_Advanced KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_EnableAutoRecover KEYNAME Software\Microsoft\Office\12.0\InfoPath VALUENAME EnableAutoRecover EXPLAIN !!L_EnableAutoRecoverExplain END POLICY POLICY !!L_AutoRecoverInterval KEYNAME Software\Microsoft\Office\12.0\InfoPath PART !!L_Empty NUMERIC VALUENAME AutoRecoverInterval SPIN 1 MIN 0 MAX 10 DEFAULT 10 END PART EXPLAIN !!L_AutoRecoverIntervalExplain END POLICY POLICY !!L_DisableCommonLanguageRuntimeerrorswhenfillingoutforms KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Form Debugging" VALUENAME ShowExceptionsDialog VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_Suppressesexceptionsthrownbyforms END POLICY CATEGORY !!L_Offline KEYNAME Software\Microsoft\Office\12.0\InfoPath\Editor\Offline POLICY !!L_Offlinedatacachedperformtemplate KEYNAME Software\Microsoft\Office\12.0\InfoPath\Editor\Offline PART !!L_Numberofbytescolon NUMERIC VALUENAME MaxCachedSolutionSize END PART EXPLAIN !!L_OfflinedatacachedperformtemplateExplain END POLICY POLICY !!L_OfflineModecachesize KEYNAME Software\Microsoft\Office\12.0\InfoPath\Editor\Offline PART !!L_Numberofbytescolon NUMERIC VALUENAME MaxCacheSize END PART EXPLAIN !!L_OfflineModecachesizeExplain END POLICY POLICY !!L_OfflineModestatus KEYNAME Software\Microsoft\Office\12.0\InfoPath\Editor\Offline PART !!L_OfflineModestatus DROPDOWNLIST VALUENAME CachedModeStatus ITEMLIST NAME !!L_Disabled VALUE NUMERIC 0 NAME !!L_Enabledinuse VALUE NUMERIC 1 NAME !!L_Enablednotinuse VALUE NUMERIC 2 DEFAULT END ITEMLIST END PART EXPLAIN !!L_OfflineModestatusexplain END POLICY END CATEGORY END CATEGORY END CATEGORY CATEGORY !!L_Security KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_ControlBehaviorforWindowsSharePointServerGradualUpgrade KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Empty DROPDOWNLIST VALUENAME GradualUpgradeRedirection ITEMLIST NAME !!L_BlockAllURLRedirections VALUE NUMERIC 0 NAME !!L_AllowIntranetURLredirections VALUE NUMERIC 1 DEFAULT NAME !!L_AllowIntranetInternetURLredirections VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlBehaviorforWindowsSharePointServerGradualUpgradeExplain END POLICY POLICY !!L_DisableopeningofsolutionsfromtheInternetsecurityzone KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME AllowInternetSolutions VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_CheckedDisplaysanerroriftheuserattemptstoopenanInfoPathsolut END POLICY POLICY !!L_Disablefullytrustedsolutionsfullaccesstomachine KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME RunFullTrustSolutions VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesEnablestheoptionAllowfullytrustedformstohaveaccessto END POLICY POLICY !!L_AllowtheuseofActiveXCustomControlsinInfoPathforms KEYNAME Software\Microsoft\Office\12.0\InfoPath VALUENAME EnableActiveXControls EXPLAIN !!L_AllowtheuseofActiveXCustomControlsinInfoPathformsExplain END POLICY POLICY !!L_Runformsinrestrictedmodeifthey KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME RestrictNoPublishURL EXPLAIN !!L_RunformsinrestrictedmodeiftheyExplain END POLICY POLICY !!L_Allowfiletypesasattachmentstoforms KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Allowthesefileswhichwouldnormallybeblockedtobeaddedto1 TEXT END PART PART !!L_Allowthesefileswhichwouldnormallybeblockedtobeaddedto2 TEXT END PART PART !!L_FileTypes EDITTEXT VALUENAME UnsafeFileTypesRemove END PART EXPLAIN !!L_AllowfiletypesasattachmentstoformsExplain END POLICY POLICY !!L_Blockspecificfiletypesasattachmentstoforms KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Preventthesefiletypesfrombeingaddedtoforms1 TEXT END PART PART !!L_Preventthesefiletypesfrombeingaddedtoforms2 TEXT END PART PART !!L_FileTypes EDITTEXT VALUENAME UnsafeFileTypesAdd END PART EXPLAIN !!L_BlockspecificfiletypesasattachmentstoformsExplain END POLICY POLICY !!L_Preventusersfromallowingunsafefiletypestobeattachedtoforms KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME DisallowAttachmentCustomization EXPLAIN !!L_PreventusersfromallowingunsafefiletypestobeattachedtoformsExplain END POLICY POLICY !!L_Displayawarningthataformisdigitallysigned KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME SignatureWarning EXPLAIN !!L_DisplayawarningthataformisdigitallysignedExplain END POLICY POLICY !!L_ControlbehaviorwhenopeningformsintheInternetsecurityzone KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Open Behaviors" PART !!L_WhenopeningformsfromtheInternetsecurityzonethat1 TEXT END PART PART !!L_WhenopeningformsfromtheInternetsecurityzonethat2 DROPDOWNLIST VALUENAME Internet ITEMLIST NAME !!L_Block VALUE NUMERIC 0 DEFAULT NAME !!L_Prompt VALUE NUMERIC 1 NAME !!L_Allow VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlbehaviorwhenopeningformsintheInternetsecurityzoneExplain END POLICY POLICY !!L_ControlbehaviorwhenopeningformsintheIntranetsecurityzone KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Open Behaviors" PART !!L_WhenopeningformsfromtheIntranetsecurityzonethat1 TEXT END PART PART !!L_WhenopeningformsfromtheIntranetsecurityzonethat2 DROPDOWNLIST VALUENAME Intranet ITEMLIST NAME !!L_Block VALUE NUMERIC 0 DEFAULT NAME !!L_Prompt VALUE NUMERIC 1 NAME !!L_Allow VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlbehaviorwhenopeningformsintheIntranetsecurityzoneExplain END POLICY POLICY !!L_ControlbehaviorwhenopeningformsintheLocalMachinesecurityzone KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Open Behaviors" PART !!L_WhenopeningformsfromtheLocalMachinesecurityzonethat1 TEXT END PART PART !!L_WhenopeningformsfromtheLocalMachinesecurityzonethat2 DROPDOWNLIST VALUENAME "Local Machine" ITEMLIST NAME !!L_Block VALUE NUMERIC 0 DEFAULT NAME !!L_Prompt VALUE NUMERIC 1 NAME !!L_Allow VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlbehaviorwhenopeningformsintheLocalMachinesecurityzoneExplain END POLICY POLICY !!L_ControlbehaviorwhenopeningformsintheTrustedSitesecurityzone KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Open Behaviors" PART !!L_WhenopeningformsfromtheTrustedSitesecurityzonethat1 TEXT END PART PART !!L_WhenopeningformsfromtheTrustedSitesecurityzonethat2 DROPDOWNLIST VALUENAME "Trusted Site" ITEMLIST NAME !!L_Block VALUE NUMERIC 0 DEFAULT NAME !!L_Prompt VALUE NUMERIC 1 NAME !!L_Allow VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlbehaviorwhenopeningformsintheTrustedSitesecurityzoneExplain END POLICY POLICY !!L_BeaconingUIPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_BeaconingUIPart DROPDOWNLIST VALUENAME InfoPathBeaconingUI ITEMLIST NAME !!L_BeaconNever VALUE NUMERIC 0 DEFAULT NAME !!L_BeaconAlways VALUE NUMERIC 1 NAME !!L_BeaconSome VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_BeaconingUIExplain END POLICY POLICY !!L_ActiveXBeaconingUIPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_ActiveXBeaconingUIPart DROPDOWNLIST VALUENAME EditorActiveXBeaconingUI ITEMLIST NAME !!L_ActiveXBeaconNever VALUE NUMERIC 0 DEFAULT NAME !!L_ActiveXBeaconAlways VALUE NUMERIC 1 NAME !!L_ActiveXBeaconSome VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ActiveXBeaconingUIExplain END POLICY CATEGORY !!L_TrustCenter KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_Disableallapplicationextensions KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME DisableAllAddins VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_Disableallapplicationextensions END POLICY POLICY !!L_RequirethatApplicationExtensionsaresigned KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME RequireAddinSig VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_RequirethatApplicationExtensionsaresignedExplain END POLICY POLICY !!L_DisableTrustBarNotificationforunsigned KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME NoTBPromptUnsignedAddin VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableTrustBarNotificationforunsignedExplain END POLICY END CATEGORY END CATEGORY CATEGORY !!L_EMailFormsCategory KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_ControlbehaviorwhenopeningInfoPathemailformsconta KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Empty DROPDOWNLIST VALUENAME EMailFormsRunCodeAndScript ITEMLIST NAME !!L_Runwithoutprompting VALUE NUMERIC 0 NAME !!L_Promptbeforerunning VALUE NUMERIC 1 DEFAULT NAME !!L_Neverrun VALUE NUMERIC 2 END ITEMLIST END PART EXPLAIN !!L_ControlbehaviorwhenopeningInfoPathemailformscontaExplain END POLICY POLICY !!L_FormTemplatePolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Deployment VALUENAME MailXSNwithXML VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_FormTemplateExplain END POLICY POLICY !!L_DisableCacheXSNPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Deployment VALUENAME CacheMailXSN VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableCacheXSNExplain END POLICY POLICY !!L_DisableEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath VALUENAME DisableInfoPath2003EmailForms VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableEmailFormsExplain END POLICY POLICY !!L_RestrictedEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME EnableRestrictedEMailForms VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_RestrictedEmailFormsExplain END POLICY POLICY !!L_DisableInternetEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME EnableInternetEMailForms VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableInternetEmailFormsExplain END POLICY POLICY !!L_DisableIntranetEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME EnableIntranetEMailForms VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableIntranetEmailFormsExplain END POLICY POLICY !!L_DisableFullTrustEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security VALUENAME EnableFullTrustEmailForms VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableFullTrustEmailFormsExplain END POLICY POLICY !!L_DisableOutlookEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\Outlook\Options\Mail VALUENAME DisableInfopathForms VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableOutlookEmailFormsExplain END POLICY POLICY !!L_DisableExporttoExcelEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\Outlook\Options\InfoPath VALUENAME DisableExportToExcel VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableExporttoExcelEmailFormsExplain END POLICY POLICY !!L_DisableMergeEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\Outlook\Options\InfoPath VALUENAME DisableMergeInInfoPath VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableMergeEmailFormsExplain END POLICY POLICY !!L_DisableExportEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\Outlook\Options\InfoPath VALUENAME DisableExportInfoPathForms VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisableExportEmailFormsExplain END POLICY POLICY !!L_DisablePropertyPromoEmailFormsPolicy KEYNAME Software\Microsoft\Office\12.0\Outlook\Options\InfoPath VALUENAME DisableInfoPathPropertyPromotion VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisablePropertyPromoEmailFormsExplain END POLICY END CATEGORY CATEGORY !!L_RestrictedFeatures KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures POLICY !!L_DisableIRM KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME IRMAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableIRMExplain END POLICY POLICY !!L_DisableCustomcode KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME CodeAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_Customcodeexplain END POLICY CATEGORY !!L_DataConnections KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures POLICY !!L_DataConnections KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataConnectionsExplain END POLICY POLICY !!L_DataConnectionstodatabases KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionDatabaseAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataConnectionstodatabasesExplain END POLICY POLICY !!L_DataConnectionsfromDataConnectionLibrary KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionDCLAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataConnectionsfromDataConnectionLibraryExplain END POLICY POLICY !!L_Modifyingthelistofservers KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionDCLServerManagementAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_ModifyingthelistofserversExplain END POLICY POLICY !!L_DataconnectionstoSharePoint KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionSharePointAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataconnectionstoSharePointExplain END POLICY POLICY !!L_DataconnectionstoWebservices KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionWebServiceAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataconnectionstoWebservicesExplain END POLICY POLICY !!L_DataconnectionstoXMLfiles KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME DataConnectionXMLAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DataconnectionstoXMLfilesExplain END POLICY END CATEGORY CATEGORY !!L_Submit KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures POLICY !!L_DisableSubmitEmailPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToEmailAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableSubmitEmailExplain END POLICY POLICY !!L_Disbalesubmitdatatohostingenvironment KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToHostingEnvironmentAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisbalesubmitdatatohostingenvironmentExplain END POLICY POLICY !!L_DisablesubmitdataviaHTTP KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToHTTPAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesubmitdataviaHTTPExplain END POLICY POLICY !!L_Disablesubmitdatausingcode KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitViaCodeAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesubmitdatausingcodeExplain END POLICY POLICY !!L_Disablesubmitusingrules KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitViaRulesAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesubmitusingrulesExplain END POLICY POLICY !!L_DisableSubmitMasterPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisableSubmitMasterExplain END POLICY POLICY !!L_Submitdatatodatabases KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToDatabaseAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_SubmitdatatodatabasesExplain END POLICY POLICY !!L_DisablesubmitdatatoSharePoint KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToSharePointAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesubmitdatatoSharePointExplain END POLICY POLICY !!L_DisablesubmitdatatoWebServices KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME SubmitToWebServiceAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablesubmitdatatoWebServicesExplain END POLICY END CATEGORY CATEGORY !!L_Publish KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures POLICY !!L_DisablePublishPropertyPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME PublishAsPropertyEditorTemplateAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablePublishPropertyExplain END POLICY POLICY !!L_Publishinstallableformtemplates KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME PublishInstallableTemplateAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_PublishinstallableformtemplatesExplain END POLICY POLICY !!L_DisablePublishEmailPolicy KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME PublishViaEmailAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_DisablePublishEmailExplain END POLICY POLICY !!L_PublishtoSharePoint KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer\RestrictedFeatures VALUENAME PublishToSharePointOrFormServerAllowed VALUEON NUMERIC 0 VALUEOFF NUMERIC 1 EXPLAIN !!L_Thissettingcontrolswhetherformtemplates END POLICY END CATEGORY END CATEGORY CATEGORY !!L_Miscellaneous KEYNAME Software\Microsoft\Office\12.0\InfoPath POLICY !!L_EmailFormsBeaconingUI KEYNAME Software\Microsoft\Office\12.0\InfoPath\Security PART !!L_Empty DROPDOWNLIST VALUENAME EmailFormsBeaconingUI ITEMLIST NAME !!L_NeverShowUI VALUE NUMERIC 0 NAME !!L_AlwaysshowUI VALUE NUMERIC 1 NAME !!L_ShowUIifXSNisinInternetZone VALUE NUMERIC 2 DEFAULT END ITEMLIST END PART EXPLAIN !!L_EmailFormsBeaconingUIExplain END POLICY POLICY !!L_URLoflocationwhereTemplatepartsareStored KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer PART !!L_EnterURL EDITTEXT VALUENAME IPCustomControlsFolder END PART EXPLAIN !!L_URLoflocationwhereTemplatepartsareStoredExplain END POLICY POLICY !!L_DisableMicrosoftOfficeInfoPathEditiorControl KEYNAME Software\Microsoft\Office\12.0\InfoPath\Editor\ActiveXControl VALUENAME Disable VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisablehostingtheMicrosoftOfficeInfoPathEditior END POLICY POLICY !!L_DisableInfoPathDesignermode KEYNAME Software\Microsoft\Office\12.0\InfoPath\Designer VALUENAME DisableDesigner VALUEON NUMERIC 1 VALUEOFF NUMERIC 0 EXPLAIN !!L_DisablesEnablestheDesignaFormcommandintheFilemenuandonthetas END POLICY POLICY !!L_SpecifypathtoInfoPathupdater KEYNAME Software\Microsoft\Office\12.0\InfoPath\Update PART !!L_SpecifypathtoInfoPathupdater EDITTEXT VALUENAME Location END PART PART !!L_Usedwhenopeningaformtemplatethatis1 TEXT END PART PART !!L_Usedwhenopeningaformtemplatethatis2 TEXT END PART EXPLAIN !!L_SpecifiesthelocationwhereuserscanobtainanupdatedversionofInf END POLICY POLICY !!L_Specifycustommessageforincompatiblesolutions KEYNAME Software\Microsoft\Office\12.0\InfoPath\Update PART !!L_Specifymessageforincompatiblesolutions EDITTEXT VALUENAME Message END PART PART !!L_Usedwhenopeningaformtemplatethatis1 TEXT END PART PART !!L_Usedwhenopeningaformtemplatethatis2 TEXT END PART EXPLAIN !!L_SpecifiesanerrormessagetodisplayifthepolicySpecifypathtoInfo END POLICY POLICY !!L_Allowuserstoturnonandoffprintingofbackgroundcolors KEYNAME "Software\Microsoft\Office\12.0\InfoPath\Internet Explorer\Main" PART !!L_Allowuserstoturnonandoffprintingofbackgroundcolors DROPDOWNLIST VALUENAME Print_Background ITEMLIST NAME !!L_Yes VALUE "Yes" DEFAULT NAME !!L_No VALUE "No" END ITEMLIST END PART EXPLAIN !!L_YesDisablestheoptionPrintbackgroundcolorsinGeneraltaboftheTo END POLICY POLICY !!L_EnterURLoflocationwhereuserscandownloadFormimporters KEYNAME Software\Microsoft\Office\12.0\InfoPath\NewImporter PART !!L_EnterURL EDITTEXT VALUENAME Location END PART EXPLAIN !!L_String END POLICY END CATEGORY END CATEGORY [Strings] L_DisableTrustBarNotificationforunsignedExplain="This setting means Office applications will silently disable any DLL containing an application add-in which does not have a digital signature. It is used in conjuntion with the 'Require that application add-ins are signed by Trusted Publisher' option which must first be set to cause the application to actually check for signatures." L_DisableTrustBarNotificationforunsigned="Disable Trust Bar Notification for unsigned application add-ins" L_RequirethatApplicationExtensionsaresignedExplain="This setting means Office applications will check the digital signature on the .DLL containing an application add-in, and will give the user a security notification in the event of an unsigned DLL or a DLL signed by a publishers certificate that has not been added to the Trusted Publishers list." L_RequirethatApplicationExtensionsaresigned="Require that application add-ins are signed by Trusted Publisher" L_TrustCenter="Trust Center" L_Disableallapplicationextensions="Disable all application add-ins" L_Empty=" " L_Checkspellingasyoutype="Check spelling as you type" L_ChecksUnchecksthecorrespondingUIoption="Checks/Unchecks the corresponding UI option." L_General="General" L_LefttoRight="Left to Right" L_Miscellaneous="Miscellaneous" L_Recentlyusedfilelist="Number of documents in the Recent Documents list" L_RighttoLeft2="Right to Left" L_Security="Security" L_ToolsOptions="Tools | Options..." L_InfoPathAPTCAAssemblyWhitelistExplain="InfoPath stores a whitelist corresponding to the assemblies located in the GAC (Global Assembly Cache) which have the Allow Partially Trust Callers Attribute (APTCA) set. An InfoPath form's business logic can only call into APTCA assemblies in the GAC which are on this whitelist. To add a new assembly to the whitelist, add a new String Value entry to the APTCA key. The Value Name field should be the public key token for the assembly and the Value Data field should be ''1'' for InfoPath to allow loading the assembly. If the Value Data field is not ''1'' the assembly will fail to load." L_InfoPathAPTCAAssemblyWhitelist="InfoPath APTCA Assembly Whitelist" L_InfoPathAPTCAAssemblyWhitelistEnforcement="InfoPath APTCA Assembly Whitelist Enforcement" L_InfoPathAPTCAAssemblyWhitelistEnforcementExplain="InfoPath stores a list of safe assemblies located in the GAC (Global Assembly Cache) that an InfoPath form's business logic can call. Business logic can only call into assemblies in the GAC that are on the safe list. This policy controls the enforcement of the safe list. By default, assemblies in the GAC that are not on the safe list cannot be loaded from business logic." L_URLoflocationwhereTemplatepartsareStored="Enter URL of location where template parts are stored" L_URLoflocationwhereTemplatepartsareStoredExplain="Specify a location where Template Parts are stored. Template Parts in this location are automatically recognized by InfoPath and displayed in the Custom Controls Task Pane." L_ControlBehaviorforWindowsSharePointServerGradualUpgrade="Control behavior for Windows SharePoint Services gradual upgrade" L_ControlBehaviorforWindowsSharePointServerGradualUpgradeExplain="This setting controls whether forms and form templates follow URL redirections provided by Windows SharePoint Services when performing a gradual upgrade. By default, InfoPath will prompt before redirecting forms or form templates to another intranet site." L_BlockAllURLRedirections="Block all URL redirections" L_AllowIntranetURLredirections="Allow URL redirections to intranet locations" L_AllowIntranetInternetURLredirections="Allow URL redirections to internet or intranet locations" L_InfPropPanand3rdparty="InfoPath.exe, Document Information Panel, Workflow forms and 3rd Party Hosting" L_InfopathexeandPropertyPanel="InfoPath.exe, Document Information Panel and Workflow forms" L_None="None" L_MicrosoftIEFeatureControlOptin="Windows Internet Explorer Feature Control Opt-In" L_MicrosoftIEFeatureControlOptinExplain="InfoPath hosts Windows Internet Explorer. This setting opts InfoPath into the following set of Windows Internet Explorer Feature Controls which lock down behavior:\n\nInstall ActiveX controls, File download, Bind to object, Security band, Manage add-ons, Disable user name, MIME handling, MIME sniffing, Object caching, Popup blocker, Check saved files, Navigate URL, Window restrictions, Zone elevation. By default Feature Control Lockdown is turned on for InfoPath.exe, Document Information Panel, Workflow forms and 3rd Party Hosting. You can also change this setting so that it is only turned on for InfoPath.exe, Document Information Panel, and Workflow forms or turn it off completely." L_Neverrun="Never run" L_Promptbeforerunning="Prompt before running" L_Runwithoutprompting="Run without prompting" L_ControlbehaviorwhenopeningInfoPathemailformscontaExplain="This setting controls whether script or code is run when opening an InfoPath e-mail form. By default, InfoPath will prompt before opening a form template which contains code or script. When this setting is set to run code or script without a prompt, InfoPath e-mail forms containing code or script will open without users seeing a prompt. When this setting is set to never run script, InfoPath e-mail forms containing code or script will error on open." L_ControlbehaviorwhenopeningInfoPathemailformsconta="Control behavior when opening InfoPath e-mail forms containing code or script" L_PublishtoSharePoint="Publish to Windows SharePoint Services or Form Services" L_DisablesubmitusingrulesExplain="Control whether new form templates can be designed to submit data using rules." L_Disablesubmitusingrules="Submit data using rules" L_DisablesubmitdatausingcodeExplain="Control whether form templates can be designed to submit data using code." L_Disablesubmitdatausingcode="Submit data using code" L_DisablesubmitdataviaHTTPExplain="Disables hosting the Microsoft Office InfoPath Editor Control 2007 in custom applications. (Can also be used to turn off the ability to host the InfoPath editor ActiveX control in a third party app.)" L_DisablesubmitdataviaHTTP="Submit data via HTTP" L_DisbalesubmitdatatohostingenvironmentExplain="Control whether new form templates can be designed to submit data to a host application." L_Disbalesubmitdatatohostingenvironment="Submit data to hosting environment" L_OfflineModecachesizeExplain="InfoPath caches data returned from querying data sources. This cached data can then be used when data sources are not accessible. This policy sets the max size of disk space to allocate to cached data." L_OfflineModecachesize="Offline Mode cache size" L_Numberofbytescolon="Number of bytes:" L_OfflinedatacachedperformtemplateExplain="InfoPath caches data returned from querying data sources. This cached data can then be used when data sources are not accessible. Data is cached across all instances of a form template. This policy controls the maximum size of data to cache for form templates." L_Offlinedatacachedperformtemplate="Offline data cached per form template" L_ShowUIifXSNisinInternetZone="Show UI if XSN is in Internet Zone" L_AlwaysshowUI="Always show UI" L_NeverShowUI="Never show UI" L_EmailFormsBeaconingUIExplain="Controls when Security UI pertaining to beaconing threats is shown for InfoPath forms opened from Outlook." L_EmailFormsBeaconingUI="Email Forms Beaconing UI" L_DisablehostingtheMicrosoftOfficeInfoPathEditior="Disable hosting the Microsoft Office InfoPath Editor Control in custom applications." L_DisableMicrosoftOfficeInfoPathEditiorControl="Disable Microsoft Office InfoPath Editor Control" L_DisablesubmitdatatoWebServicesExplain="Control whether form templates can be designed to submit data to web services. If this policy is enabled, no new form template that submits to a Web Service can be created. Ability to modify existing form templates that use this feature is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DisablesubmitdatatoWebServices="Submit data to Web services" L_DisablesubmitdatatoSharePointExplain="Control whether form templates can be designed to submit data to Windows SharePoint Services servers." L_DisablesubmitdatatoSharePoint="Submit data to Windows SharePoint Services" L_DisableIRMExplain="Enforcing this policy will restrict the designer from designing Information Rights Management (IRM) protected forms." L_DisableIRM="Information Rights Management" L_PublishinstallableformtemplatesExplain="Enable this policy to disallow publishing of installable form templates." L_Publishinstallableformtemplates="Publish installable form templates" L_Publish="Publish" L_MicrosoftOfficeInfoPath12machine="Microsoft Office InfoPath 2007 (machine)" L_SubmitdatatodatabasesExplain="Control whether form templates can be designed to submit data to databases. If this policy is enabled, no new form template that submits to a database can be created. Ability to modify existing form templates that use this feature is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_Submitdatatodatabases="Submit data to databases" L_Submit="Submit" L_DataconnectionstoXMLfilesExplain="Control whether form templates can be designed to use data connections to XML files. If this policy is enabled, no new form template that uses data connections to XML files can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is not set or disabled, InfoPath Designer functionality is not affected." L_DataconnectionstoXMLfiles="Data connections to XML files" L_DataconnectionstoWebservicesExplain="Control whether form templates can be designed to use data connections to Web services. If this policy is enabled, no new form template that uses data connections to web services can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DataconnectionstoWebservices="Data connections to Web services" L_DataconnectionstoSharePointExplain="Control whether form templates can be designed to use data connections to Windows SharePoint Services libraries or lists. If this policy is enabled, no new form template that uses data connections to Windows SharePoint Services libraries can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DataconnectionstoSharePoint="Data connections to Windows SharePoint Services" L_ModifyingthelistofserversExplain="Control whether form designers can modify the list of servers to query for data connection files. If this policy is enabled, the form designer cannot modify the list of Windows SharePoint Services sites that are searched for data connections. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_Modifyingthelistofservers="Modifying the list of servers to query for data connections" L_DataConnectionsfromDataConnectionLibraryExplain="Control whether form templates can be designed to use data connections from the Data Connection Library. If this policy is disabled, no new form template that uses data connections from the Data Connection Library can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DataConnectionsfromDataConnectionLibrary="Data connections from Data Connection Library" L_DataConnectionstodatabasesExplain="Control whether form templates can be designed to use data connections to databases. Enabling this policy means no new form template that uses data connections to databases can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DataConnectionstodatabases="Data connections to databases" L_DataConnectionsExplain="Control whether form templates can be designed to use data connections. If this policy is enabled, no new form template that uses data connections can be created. Ability to modify existing form templates that use data connections is not affected. If this policy is disabled, InfoPath Designer functionality is not affected." L_DataConnections="Data Connections" L_Customcodeexplain="Control whether form templates can be designed to use custom code. If this policy is enabled, no new form template that uses code can be created. If this policy is disabled, InfoPath Designer functionality is not affected." L_DisableCustomcode="Custom code" L_OfflineModestatusexplain="Tracks if Offline Mode is enabled for InfoPath. If the ''Cache queries for use in Offline mode'' checkbox in Tools | Options | Advanced is unchecked, the policy value is ''Disabled''. If Offline Mode is enabled (policy value is not ''Disabled''), this also tracks if InfoPath is currently in Offline Mode." L_Enablednotinuse="Enabled, InfoPath not in Offline Mode" L_Enabledinuse="Enabled, InfoPath in Offline Mode" L_Disabled="Disabled" L_OfflineModestatus="Offline Mode status" L_Offline="Offline" L_Preventthesefiletypesfrombeingaddedtoforms1="Prevent these file types from being added to forms" L_Preventthesefiletypesfrombeingaddedtoforms2="Example: '.ext', or '.ext, .ex1, .ex2, <...>'" L_FileTypes="File Types:" L_Allowthesefileswhichwouldnormallybeblockedtobeaddedto1="Allow these files which would normally be blocked to be added to forms" L_Allowthesefileswhichwouldnormallybeblockedtobeaddedto2="Example: '.ext', or '.ext, .ex1, .ex2, <...>'" L_Waitmilliseconds010000="Wait: (milliseconds 0-10,000)" L_DirectionColon="Direction:" L_Displayawarningthataformisdigitallysigned="Display a warning that a form is digitally signed" L_DisplayawarningthataformisdigitallysignedExplain="This setting controls whether the user sees a dialog box when opening Microsoft Office InfoPath forms containing digitally signed content. By default, InfoPath shows the user a warning message when the form contains a digital signature. When this setting is set to disabled, this dialog box is not shown." L_Preventusersfromallowingunsafefiletypestobeattachedtoforms="Prevent users from allowing unsafe file types to be attached to forms" L_PreventusersfromallowingunsafefiletypestobeattachedtoformsExplain="Prevents the user from allowing unsafe file types to be attached to forms by listing them in the File Attachment properties dialog box." L_Blockspecificfiletypesasattachmentstoforms="Block specific file types as attachments to forms" L_BlockspecificfiletypesasattachmentstoformsExplain="A list of file types that cannot be added to forms." L_Allowfiletypesasattachmentstoforms="Allow file types as attachments to forms" L_AllowfiletypesasattachmentstoformsExplain="A list of file types that can be added to forms. This list will serve in addition to a standard list of file types that Microsoft Office InfoPath allows." L_Runformsinrestrictedmodeifthey="Run forms in restricted mode if they do not specify a publish location and use only features introduced before InfoPath 2003 SP1" L_RunformsinrestrictedmodeiftheyExplain="By default, forms created in Microsoft Office InfoPath 2003 without a publish location run in domain security mode when opened in InfoPath 2003 SP1. This policy forces these forms to run in restricted security mode that is more secure than domain security mode." L_AllowtheuseofActiveXCustomControlsinInfoPathforms="Allow the use of ActiveX Custom Controls in InfoPath forms" L_AllowtheuseofActiveXCustomControlsinInfoPathformsExplain="Permit users to make use of ActiveX Custom Controls when designing and filling out Microsoft Office InfoPath forms." L_DisableCommonLanguageRuntimeerrorswhenfillingoutforms="Disable Common Language Runtime errors when filling out forms" L_Suppressesexceptionsthrownbyforms="Suppresses exceptions thrown by forms with custom Visual Basic or C# code." L_AutoRecoverInterval="AutoRecover Interval" L_AutoRecoverIntervalExplain="Microsoft Office InfoPath can save a form's data automatically while a user is filling out a form. This options sets the amount of time between automatic saves when AutoRecover is turned on." L_EnableAutoRecover="Enable AutoRecover" L_EnableAutoRecoverExplain="Microsoft Office InfoPath can save a form's data automatically while a user is filling out a form. This option turns on AutoRecover." L_Displayashadedinkguideforhandwriting="Display a shaded ink guide for handwriting" L_DisplayashadedinkguideforhandwritingExplain="Turns on the shaded ink guide when entering text in Ink entry." L_Entermillisecondsbeforerecognizinghandwriting="Enter milliseconds before recognizing handwriting" L_EntermillisecondsbeforerecognizinghandwritingExplain="Sets the number of milliseconds that Microsoft Office InfoPath will wait before recognizing handwriting." L_DisplaywarningdialogthatuserisenteringtextinInkentrymode="Display a warning dialog box that user is entering text in Ink entry mode" L_DisplaywarningdialogthatuserisenteringtextinInkentrymodeExplain="Informs users that Ink entry is turned on by showing a warning dialog box." L_InkEntry="Ink Entry" L_InkEntryExplain="Set this option to open Microsoft Office InfoPath in Ink entry mode." L_Entertextdirectionfornewforms="Enter text direction for new forms" L_EntertextdirectionfornewformsExplain="Specifies the orientation of new forms. The forms could either be left to right (LTR) or right to left (RTL)." L_Advanced="Advanced" L_Ink="Ink" L_Design="Design" L_String="" L_ControlbehaviorwhenopeningformsintheInternetsecurityzone="Control behavior when opening forms in the Internet security zone" L_ControlbehaviorwhenopeningformsintheInternetsecurityzoneExplain="This policy allows you to control Microsoft Office InfoPath behavior when opening forms from the Internet security zone that have a mismatched template name (URN) and form location (PI Location)." L_WhenopeningformsfromtheInternetsecurityzonethat1="When opening forms from the Internet security zone that" L_WhenopeningformsfromtheInternetsecurityzonethat2="have a mismatched template name (URN) and form location (PI Location)" L_ControlbehaviorwhenopeningformsintheIntranetsecurityzone="Control behavior when opening forms in the Intranet security zone" L_ControlbehaviorwhenopeningformsintheIntranetsecurityzoneExplain="This policy allows you to control InfoPath behavior when opening forms from the Intranet security zone that have a mismatched template name (URN) and form location (PI Location)." L_WhenopeningformsfromtheIntranetsecurityzonethat1="When opening forms from the Intranet security zone that" L_WhenopeningformsfromtheIntranetsecurityzonethat2="have a mismatched template name (URN) and form location (PI Location)" L_ControlbehaviorwhenopeningformsintheLocalMachinesecurityzone="Control behavior when opening forms in the Local Machine security zone" L_ControlbehaviorwhenopeningformsintheLocalMachinesecurityzoneExplain="This policy allows you to control Microsoft Office InfoPath behavior when opening forms from the Local Machine security zone that have a mismatched template name (URN) and form location (PI Location)." L_WhenopeningformsfromtheLocalMachinesecurityzonethat1="When opening forms from the Local Machine security zone that" L_WhenopeningformsfromtheLocalMachinesecurityzonethat2="have a mismatched template name (URN) and form location (PI Location)" L_ControlbehaviorwhenopeningformsintheTrustedSitesecurityzone="Control behavior when opening forms in the Trusted Site security zone" L_ControlbehaviorwhenopeningformsintheTrustedSitesecurityzoneExplain="This policy allows you to control Microsoft Office InfoPath behavior when opening forms from the Trusted Site security zone that have a mismatched template name (URN) and form location (PI Location)." L_WhenopeningformsfromtheTrustedSitesecurityzonethat1="When opening forms from the Trusted Site security zone that" L_WhenopeningformsfromtheTrustedSitesecurityzonethat2="have a mismatched template name (URN) and form location (PI Location)" L_Prompt="Prompt" L_Block="Block" L_Allow="Allow" L_EnterURLoflocationwhereuserscandownloadFormimporters="Enter URL of location where users can download Form importers" L_EnterURL="Enter URL:" L_Allowuserstoturnonandoffprintingofbackgroundcolors="Allow users to turn on and off printing of background colors." L_CheckedDisplaysanerroriftheuserattemptstoopenanInfoPathsolut="Checked: Displays an error if the user attempts to open an InfoPath solution from a source located in the Internet security zone. | Unchecked: Allows the user to open an InfoPath solution from a source located in the Internet security zone." L_DisableInfoPathDesignermode="Disable InfoPath Designer mode" L_Disablefullytrustedsolutionsfullaccesstomachine="Disable fully trusted solutions full access to computer" L_DisableopeningofsolutionsfromtheInternetsecurityzone="Disable opening of solutions from the Internet security zone" L_DisablesEnablestheDesignaFormcommandintheFilemenuandonthetas="Disables/Enables the ''Design a Form Template'' command in the File menu and on the task pane." L_DisablesEnablestheoptionAllowfullytrustedformstohaveaccessto="Disables/Enables the option Allow fully trusted forms to run on my computer." L_EAFind="EA Find" L_Hidespellingerrors="Hide spelling errors" L_Matchchoonusedforvowels="Match cho-on used for vowels" L_Matchfullhalfwidthforms="Match full/half width forms" L_Matchminusdashcho="Match minus, dash, cho" L_MicrosoftOfficeInfoPath12="Microsoft Office InfoPath 2007" L_No="No" L_Normal="Normal" L_Numberofentries="Number of entries:" L_SelectEAlinebreakingbehavior="Select EA line breaking behavior" L_SetEAlinebreaking="Set EA line breaking" L_SetsthenumberofentriesinthefilelistintheFilemenu="Sets the number of entries in the file list in the File menu." L_SpecifiesanerrormessagetodisplayifthepolicySpecifypathtoInfo="Specifies an error message to display if the policy ''Specify path to updated version of InfoPath'' is set and a user accesses a form that requires an update to InfoPath. The error message can be used to provide information or instructions on obtaining the updated version from the location specified in the policy." L_SpecifiesthelocationwhereuserscanobtainanupdatedversionofInf="Specifies the location where users can obtain an updated version of InfoPath if a form they attempt to open requires an updated version." L_Specifycustommessageforincompatiblesolutions="Specify custom message for incompatible form templates" L_Specifymessageforincompatiblesolutions="Specify message for incompatible solutions" L_SpecifypathtoInfoPathupdater="Specify path to get updated version of InfoPath" L_SpellingGrammar="Spelling & Grammar" L_Strict="Strict" L_Usedwhenopeningaformtemplatethatis1="Used when opening a form template that is incompatible" L_Usedwhenopeningaformtemplatethatis2="with the current version of InfoPath." L_Yes="Yes" L_YesDisablestheoptionPrintbackgroundcolorsinGeneraltaboftheTo="Yes: Disables the option ''Print background colors and pictures'' in General tab of the Tools | Options dialog box. | No: Enables the option ''Print background colors and pictures'' in General tab of the Tools | Options dialog box." L_DefaultFormatPolicy="Default form templates file formats" L_DefaultFormatExplain="Specifies the default file format that InfoPath uses to save form templates." L_DefaultFormatPart="Format:" L_DefaultSaveFormat12="InfoPath Form Template (*.xsn)" L_DefaultSaveFormat11="InfoPath 2003 Form Template (*.xsn)" L_EMailFormsCategory="InfoPath e-mail forms" L_FormTemplatePolicy="Disable sending form template with e-mail forms" L_FormTemplateExplain="This setting controls the deployment of InfoPath form templates in e-mail. By default, InfoPath allows users to send the form template with the form in e-mail. When this policy is checked, users will not be able to send form templates as an attachment to mail messages from InfoPath." L_DisableCacheXSNPolicy="Disable dynamic caching of the form template in InfoPath e-mail forms" L_DisableCacheXSNExplain="This setting controls the deployment of templates with InfoPath e-mail forms. By default, InfoPath will cache form templates when attached to a mail item recognized as an InfoPath e-mail form. When this setting is enabled, InfoPath will not cache the form template attached to the mail item and will only cache the form template from the published location." L_DisableEmailFormsPolicy="Disable sending InfoPath 2003 Forms as e-mail forms" L_DisableEmailFormsExplain="This policy controls how forms compatible with InfoPath 2003 are sent by mail. By default, InfoPath will send all forms via E-mail using InfoPath e-mail forms integration with Outlook. When this setting is turned on, InfoPath will not send InfoPath 2003 compatible forms using the e-mail forms integration." L_RestrictedEmailFormsPolicy="Disable e-mail forms running in restricted security level" L_RestrictedEmailFormsExplain="This setting controls the security context in which InfoPath e-mail forms will run. By default, InfoPath e-mail forms running in the InfoPath restricted security level will be allowed to open. When this policy is enabled, InfoPath e-mail forms running in the InfoPath restricted security level fail to load and will display an error message indicating policy has disabled the feature." L_DisableInternetEmailFormsPolicy="Disable e-mail forms from the Internet security zone" L_DisableInternetEmailFormsExplain="This policy controls the security context in which InfoPath e-mail forms will run. By default, InfoPath e-mail forms running in the Internet security zone will be allowed to open. When this policy is checked InfoPath e-mail forms running in the Internet security zone fail to load and will display an error message indicating policy has disabled the feature." L_DisableIntranetEmailFormsPolicy="Disable e-mail forms from the Intranet security zone" L_DisableIntranetEmailFormsExplain="This policy controls the security context in which InfoPath e-mail forms will run. By default, InfoPath e-mail forms running in the Intranet security zone will be allowed to open. When this policy is checked InfoPath e-mail forms running in the Intranet security zone fail to load and will display an error message indicating policy has disabled the feature." L_DisableFullTrustEmailFormsPolicy="Disable e-mail forms from the Full Trust security zone" L_DisableFullTrustEmailFormsExplain="This policy controls the security context in which InfoPath e-mail forms will run. By default, InfoPath e-mail forms running in the Full Trust security zone will be allowed to open. When this policy is checked InfoPath e-mail forms running in the Full Trust security zone fail to load and will display an error message indicating policy has disabled the feature." L_DisableOutlookEmailFormsPolicy="Disable InfoPath e-mail forms in Outlook" L_DisableOutlookEmailFormsExplain="This setting controls how InfoPath forms are rendered in Outlook. By default, Outlook will use the InfoPath e-mail forms feature to render and fill out forms in Outlook. When this policy is checked, Outlook will render InfoPath forms as e-mail messages with form attachments and will disable all InfoPath e-mail form specific behavior." L_DisableExporttoExcelEmailFormsPolicy="Disable exporting InfoPath e-mail forms to Excel" L_DisableExporttoExcelEmailFormsExplain="This policy controls the ability to export InfoPath e-mail forms to Excel. By default, InfoPath e-mail forms in Outlook can be exported to create an XML list in Excel. When this setting is checked, InfoPath e-mail forms will not be allowed to export to Excel from Outlook." L_DisableMergeEmailFormsPolicy="Disable merging InfoPath e-mail forms" L_DisableMergeEmailFormsExplain="This policy controls the ability to merge InfoPath e-mail forms in InfoPath. By default, InfoPath e-mail forms in Outlook can be merged as a single InfoPath form. When this policy is checked, InfoPath e-mail forms will not be allowed to merge from Outlook." L_DisableExportEmailFormsPolicy="Disable export InfoPath e-mail forms" L_DisableExportEmailFormsExplain="This setting controls the ability to export InfoPath e-mail forms from Outlook. By default, InfoPath e-mail forms in Outlook can be exported to a file folder or other network location. When this policy is checked, InfoPath e-mail forms will not allow export from Outlook." L_DisablePropertyPromoEmailFormsPolicy="Disable InfoPath E-mail Form Property Promotion" L_DisablePropertyPromoEmailFormsExplain="This policy controls the ability to promote form data as columns in an Outlook folder. By default, InfoPath Form folders in Outlook allow InfoPath e-mail forms to promote data from the individual forms as properties. When this policy is checked, InfoPath e-mail forms will not be allowed to promote form data as properties." L_BeaconingUIPolicy="Beaconing UI for forms opened in InfoPath" L_BeaconingUIExplain="Controls when security UI pertaining to beaconing threats is shown." L_BeaconingUIPart="Beaconing UI for forms opened in InfoPath" L_BeaconNever="Never show beaconing UI" L_BeaconAlways="Always show beaconing UI" L_BeaconSome="Show UI if Form Template is from Internet Zone" L_ActiveXBeaconingUIPolicy="Beaconing UI for forms opened in InfoPath Editor ActiveX" L_ActiveXBeaconingUIExplain="Controls when Security UI pertaining to beaconing threats is shown for forms opened in the InfoPath Editor ActiveX." L_ActiveXBeaconingUIPart="Beaconing UI for forms opened in InfoPath Editor ActiveX" L_ActiveXBeaconNever="Never show beaconing UI" L_ActiveXBeaconAlways="Always show beaconing UI" L_ActiveXBeaconSome="Show UI if Form Template is from Internet Zone" L_RestrictedFeatures="Restricted Features" L_Thissettingcontrolswhetherformtemplates="Enable this policy to disallow publishing of form templates to Microsoft Office Windows SharePoint Services sites with or without Forms Services." L_DisablePublishEmailPolicy="Publish via e-mail" L_DisablePublishEmailExplain="Enable this policy to disallow publishing form templates via e-mail." L_DisablePublishPropertyPolicy="Publish as Document Information Panels" L_DisablePublishPropertyExplain="Enable this policy to disallow publishing of form templates as Document Information Panels." L_DisableSubmitMasterPolicy="Submit data (master switch)" L_DisableSubmitMasterExplain="This policy prevents users from being able to design Forms that submit data (allowed by default). This key overrides more granular keys such as 'Submit data to databases' and 'Submit data to Windows SharePoint Services'. Ability to modify existing templates that use this feature is unaffected." L_DisableSubmitEmailPolicy="Submit data via e-mail" L_DisableSubmitEmailExplain="Control whether form templates can be designed to submit data via e-mail. If this policy is enabled, no new form template that submits via e-mail can be created. Ability to modify existing form templates that use this feature is not affected. If this policy is disabled, InfoPath Designer functionality is not affected."